Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
780	irgsp1_rep	chr01	5478545	5479749	+	189	3	Os01g0200700

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS7

Gene Family

GF6790	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0005507	copper ion binding
GO:0005576	extracellular region
GO:0005623	cell
GO:0006612	protein targeting to membrane
GO:0006833	water transport
GO:0006878	cellular copper ion homeostasis
GO:0006970	response to osmotic stress
GO:0007389	pattern specification process
GO:0008361	regulation of cell size
GO:0009651	response to salt stress
GO:0009750	response to fructose
GO:0009926	auxin polar transport
GO:0009963	positive regulation of flavonoid biosynthetic process
GO:0010015	root morphogenesis
GO:0010363	regulation of plant-type hypersensitive response
GO:0040007	growth
GO:0046686	response to cadmium ion

CDS(Coding DNA Sequence)

>Os01g0200700
ATGTCGGACAAGTGCGGCAACTGCGACTGTGCTGACAAGAGCCAGTGCGTGAAGAAAGGTACCAGCTATGGCGTCGTCATAGTTGAAGCCGAGAAGAGCCACTTCGAGGAGGTCGCCGCCGGCGAGGAGAACGGCGGCTGCAAGTGCGGCACCAGCTGCTCCTGCACCGACTGCAAGTGCGGCAAGTGA

Protein Sequence

>Os01g0200700
MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFEEVAAGEENGGCKCGTSCSCTDCKC
GK*