Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
1421	irgsp1_rep	chr01	11202609	11203331	-	375	3	Os01g0303000

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Family

GF3658	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0005515	protein binding
GO:0009416	response to light stimulus
GO:0009507	chloroplast
GO:0009570	chloroplast stroma
GO:0009637	response to blue light
GO:0009644	response to high light intensity
GO:0009744	response to sucrose
GO:0010114	response to red light
GO:0010155	regulation of proton transport
GO:0010218	response to far red light
GO:0018316	peptide cross-linking via L-cystine
GO:0019253	reductive pentose-phosphate cycle
GO:0034605	cellular response to heat
GO:0043234	protein complex
GO:0070417	cellular response to cold
GO:0071454	cellular response to anoxia
GO:0080153	negative regulation of reductive pentose-phosphate cycle

CDS(Coding DNA Sequence)

>Os01g0303000
ATGGCGTCCACGCTGACCAACGTCGGCCTGTCTACCCCGGCGGCGGCGGCGTCGTCCCTCGTTAGGCCGGTCGCCGGAGCTGGACGCGTGGTGTTTCCCCGTGTTGGCCGCGGCGGGTTCGCGGCGGTGAGGGCGAGCGGGCCGGCGACGCCGCCGGACATCTCGGACAAGATGTCGGAGAGCATCGACAAGGCGAAGGAGGCGTGCGCGGAGGACACGGCGAGCGGCGAGTGCGCGGCGGCGTGGGACGAGGTGGAGGAGCTGAGCGCGGCGGCGAGCCACGCGCGCGACAAGCTCAAGGAGACCTCCGACCCGCTCGAGGCCTACTGCAAGGACAACCCGGAGACCGACGAGTGCCGCACCTACGACAACTGA

Protein Sequence

>Os01g0303000
MASTLTNVGLSTPAAAASSLVRPVAGAGRVVFPRVGRGGFAAVRASGPATPPDISDKMSE
SIDKAKEACAEDTASGECAAAWDEVEELSAAASHARDKLKETSDPLEAYCKDNPETDECR
TYDN*