Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
1422	irgsp1_rep	chr01	11208573	11209811	+	1008	1	Os01g0303100

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Ontology

GO:0000272	polysaccharide catabolic process
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0006032	chitin catabolic process
GO:0007109	obsolete cytokinesis, completion of separation
GO:0008843	endochitinase activity
GO:0009409	response to cold
GO:0009611	response to wounding
GO:0009642	response to light intensity
GO:0009651	response to salt stress
GO:0010228	vegetative to reproductive phase transition of meristem
GO:0016926	protein desumoylation
GO:0042631	cellular response to water deprivation
GO:0050665	hydrogen peroxide biosynthetic process

CDS(Coding DNA Sequence)

>Os01g0303100
ATGCATTGCTATATCTCTCTCTCGTCGATCTGCAGATCGACCAAGCAATACACAATGGCCACTCGGGCAAACGGCAGCTCATGCTCCCTGGCCAGCCTCATGGCGGCCATCTTCTTCCTCCTAGTCGTCTCCTCCCGGGgcgcccatggcggcagaattgccatctactggggccagaacggcaacgagggcaccctcgccgacacctgcgccacgggcaactacgccttcgtcaacctcgccttcctctgcagcttcggctcgggccaggccccgcagctcaacctcgccggccactgcgacgcctactcgggcgcctgcgccaacctcaccgccgacatcgcccgctgccagtccatgggcgtcaaggtcctcctctccatcggcggcggcgccggcggctactcgctcgcctccaagcaggacgtgtcccacctcgcccggtacctctgggagagcttcctcggcggccgcccgtcggcgccgggcggcaggaggccgctcggcgacgcggtgctcgacggcgtcgacttcgacatcgagggcggcggcggcgacccccgctactacggcgacctcgccgcgtacctcaaggcgtacagcggcaagggcgccgccggcaaggaggtgctcctctcggcggcgccgcagtgcccgttcccggaccagtgggtcggcaaggcgctcgacaccggcctgttcgactacgtgtgggtgcagttctacaacaacccgccgtgccagtacgccgcagggagcggcggcggcgccgccaacctgctcgacgcatggcgccagtggacgtcgggggtggaggccaggtacatcttcctcgggctgccggcgtcgcccggcgcggcggggagcgggttcatcccggtggggagcctcgagtcgcaggtgttgccggcgctgaaggcgtcgagcaagtacggcggggtgatgctgtggtccaggtactacgacgatcaggatggatacagctccgccatcaagAATGCCGTCTGA

Protein Sequence

>Os01g0303100
MHCYISLSSICRSTKQYTMATRANGSSCSLASLMAAIFFLLVVSSRGAHGGRIAIYWGQN
GNEGTLADTCATGNYAFVNLAFLCSFGSGQAPQLNLAGHCDAYSGACANLTADIARCQSM
GVKVLLSIGGGAGGYSLASKQDVSHLARYLWESFLGGRPSAPGGRRPLGDAVLDGVDFDI
EGGGGDPRYYGDLAAYLKAYSGKGAAGKEVLLSAAPQCPFPDQWVGKALDTGLFDYVWVQ
FYNNPPCQYAAGSGGGAANLLDAWRQWTSGVEARYIFLGLPASPGAAGSGFIPVGSLESQ
VLPALKASSKYGGVMLWSRYYDDQDGYSSAIKNAV*

Gene Information

Basic Gene Information

Gene Categorization (Help)

Gene Family

Gene Distribution (Help)

Gene Presence Frequency

Gene Ontology

CDS(Coding DNA Sequence)

Protein Sequence