Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
1649	irgsp1_rep	chr01	14453690	14454549	+	270	4	Os01g0357200

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS2

Gene Family

GF2633	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0005623	cell
GO:0005777	peroxisome
GO:0006635	fatty acid beta-oxidation
GO:0007031	peroxisome organization
GO:0009507	chloroplast
GO:0009686	gibberellin biosynthetic process
GO:0009735	response to cytokinin
GO:0009740	gibberellic acid mediated signaling pathway
GO:0009845	seed germination
GO:0032365	intracellular lipid transport
GO:0032934	sterol binding
GO:0046487	glyoxylate metabolic process
GO:0048608	reproductive structure development

CDS(Coding DNA Sequence)

>Os01g0357200
ATGGAAGGGAGCAACCTCAAGTCGGCTGCGCTACTGGAGCAGTTGCATGTCCACCTCGCGTCCGGCGCCGGCAAGGAGCTCGTCGAAATGATCGGCTTCGTCTACCAGCTCAACATCTCTCCCAAGAAACTCGGTTTCGACGAGGAGGTATTCATCGTCGTCGATCTCAAGAAGGGCGTCGTCTCCAAAGGGCCGTACGAGGGGAAGCCAGACGCGACCTTCTCCTTCACGGACGACGATTTCCTGGCCATCTCCAGCGGGGCAAATTGA

Protein Sequence

>Os01g0357200
MEGSNLKSAALLEQLHVHLASGAGKELVEMIGFVYQLNISPKKLGFDEEVFIVVDLKKGV
VSKGPYEGKPDATFSFTDDDFLAISSGAN*