Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
2887	irgsp1_rep	chr01	28538881	28539369	-	339	3	Os01g0691300

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS6

Gene Family

GF193	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0005576	extracellular region
GO:0005623	cell
GO:0006612	protein targeting to membrane
GO:0006869	lipid transport
GO:0008289	lipid binding
GO:0009963	positive regulation of flavonoid biosynthetic process
GO:0010363	regulation of plant-type hypersensitive response

CDS(Coding DNA Sequence)

>Os01g0691300
ATGACGACGAGGCCTTCTGTTTTTTCCACCGTTGTCGCGGCGATCGCCATCGCCGCGCTGCTGAGCAGCCTCCTCCTCCTGCAGGCTACCCCGGCCGCGGCCAGCGCGAGGGCCTCGAAGAAGGCTTCGTGCGACCTGATGCAGCTGAGCCCGTGCGTCAGCGCGTTCTCCGGTGTGGGGCAGGGCTCGCCATCGTCCGCGTGCTGCTCCAAGCTCAAGGCGCAGGGCTCCAGCTGCCTGTGCCTCTACAAGGACGACCCCAAAGTGAAGCGCATTGTCAGCTCCAATCGCACCAAGAGGGTCTTCACCGCGTGCAAGGTGCCCGCGCCGAACTGCTAA

Protein Sequence

>Os01g0691300
MTTRPSVFSTVVAAIAIAALLSSLLLLQATPAAASARASKKASCDLMQLSPCVSAFSGVG
QGSPSSACCSKLKAQGSSCLCLYKDDPKVKRIVSSNRTKRVFTACKVPAPNC*