Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
3588	irgsp1_rep	chr01	33448396	33449269	+	441	2	Os01g0788200

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Family

GF2292	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0005622	intracellular
GO:0005623	cell
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005737	cytoplasm
GO:0006605	protein targeting
GO:0006606	protein import into nucleus
GO:0006869	lipid transport
GO:0006891	intra-Golgi vesicle-mediated transport
GO:0006913	nucleocytoplasmic transport
GO:0008536	Ran GTPase binding
GO:0008565	protein transporter activity
GO:0010351	lithium ion transport
GO:0016558	protein import into peroxisome matrix

CDS(Coding DNA Sequence)

>Os01g0788200
ATGGACGGGCATGGGAAGGAGGGCAGCAGCAACGGCGCCAGCGGCGGCGGCGGCGGCGGCTGGAGCGATCAGTGCGACGTGGTGGCCAGGGCCTTCGTGGAGTACTACTACCAGACGTTCGACACCAACCGCGCCGCGCTCGCCGCGCTCTACGGCCAGACGTCCATGCTCTCCTTCGAGGGACACATGGTGGCCGGCGCCGAGGAGATCGGCCGGAAGCTGTTGGGGCTGCCCTTCGAGCAATGCCGGCACGCCGTCTGCACCGTCGACTGCCAACCCACGCCGTccttcccgggaggcatcctcgtcttcgtcagtggcaacctccagctcgccggcgaggagcaccagctcaggttcagccagATGTTTCAGCTGGTGCCCAACGAGCAGGGAAGCTTCTTCGTGCAGAATGACATATTCCGGCTCAACTACGGCTAG

Protein Sequence

>Os01g0788200
MDGHGKEGSSNGASGGGGGGWSDQCDVVARAFVEYYYQTFDTNRAALAALYGQTSMLSFE
GHMVAGAEEIGRKLLGLPFEQCRHAVCTVDCQPTPSFPGGILVFVSGNLQLAGEEHQLRF
SQMFQLVPNEQGSFFVQNDIFRLNYG*