Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
4500	irgsp1_rep	chr01	40061648	40063633	-	306	5	Os01g0918200

Gene Categorization (Help)

Core gene	No
Candidate core gene	No
Distributed gene	Yes
Subspecies-unbalanced gene	Yes
Indica-dominant gene	No
Japonica-dominant gene	Yes
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Family

GF639	Core Gene Family

Gene Distribution (Help)

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0005515	protein binding
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0006094	gluconeogenesis
GO:0007010	cytoskeleton organization
GO:0009408	response to heat
GO:0010286	heat acclimation
GO:0010498	proteasomal protein catabolic process
GO:0016925	protein sumoylation
GO:0031386	protein tag
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity

CDS(Coding DNA Sequence)

>Os01g0918200
ATGTCGTCGCCCGCGGGGGAGGATGAGAAGAAGCCGGCGGGGGGAGAGGGCGGCGGCGCCCACATCAACCTCAAGGTCAAGGGACAGGATGGCAACGAGGTGTTCTTTCGTATCAAGAGATCAACCCAACTGAAGAAGCTGATGAACGCCTACTGTGATCGCCAGTCCGTGGATATCAAATCTATTGCCTTCCTGTTTGATGGTCGTAGGCTCAATGCTGAGCAGACCCCTGACCAGCTCGAGATGGAAGACGGCGACGAGATTGACGCCATGCTTCACCAGACTGGGGGCTCTCTGCCTGCCTAG

Protein Sequence

>Os01g0918200
MSSPAGEDEKKPAGGEGGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDIK
SIAFLFDGRRLNAEQTPDQLEMEDGDEIDAMLHQTGGSLPA*