Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
4615	irgsp1_rep	chr01	40909710	40914137	-	165	7	Os01g0932550

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS2

Gene Family

GF1786	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0001510	RNA methylation
GO:0005507	copper ion binding
GO:0005623	cell
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005758	mitochondrial intermembrane space
GO:0006626	protein targeting to mitochondrion
GO:0009507	chloroplast
GO:0015450	P-P-bond-hydrolysis-driven protein transmembrane transporter activity
GO:0071806	protein transmembrane transport

CDS(Coding DNA Sequence)

>Os01g0932550
CCCGGTTCCAAGCAGACTGTTGGGAGCAAGTGCTTTGCCAAGTGTGTGACAAAGCCAGGCTCAAGCTTGAGCGGTAGCGAGAGCAGTTGCATATCTCGCTGTGTTGATCATTACATTGAGGCAACTGGTATTGTCAGCCGAGCTCTATTCAGTACCACACGCTGA

Protein Sequence

>Os01g0932550
PGSKQTVGSKCFAKCVTKPGSSLSGSESSCISRCVDHYIEATGIVSRALFSTTR*