Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
4688	irgsp1_rep	chr01	41343327	41344264	+	438	2	Os01g0940600

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS8

Gene Ontology

GO:0000165	MAPK cascade
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576	extracellular region
GO:0005618	cell wall
GO:0005623	cell
GO:0005975	carbohydrate metabolic process
GO:0006612	protein targeting to membrane
GO:0008810	cellulase activity
GO:0009409	response to cold
GO:0009595	detection of biotic stimulus
GO:0009617	response to bacterium
GO:0009627	systemic acquired resistance
GO:0009697	salicylic acid biosynthetic process
GO:0009814	defense response, incompatible interaction
GO:0009862	systemic acquired resistance, salicylic acid mediated signaling pathway
GO:0009867	jasmonic acid mediated signaling pathway
GO:0010200	response to chitin
GO:0010310	regulation of hydrogen peroxide metabolic process
GO:0010363	regulation of plant-type hypersensitive response
GO:0019684	photosynthesis, light reaction
GO:0031348	negative regulation of defense response
GO:0034976	response to endoplasmic reticulum stress
GO:0042742	defense response to bacterium
GO:0043900	regulation of multi-organism process
GO:0045088	regulation of innate immune response
GO:0048046	apoplast
GO:0050832	defense response to fungus

CDS(Coding DNA Sequence)

>Os01g0940600
ATGGCGGCGCGAGGTCTCGCTGCTCTCTCCTCCCCGGCGCGCGTCGGCGCGAGCGCTACGCCGTGCTCTGGGAGGCCTGTCCGTGTATCGGCTACGCCGGCAGCGGGCGGCTGGCGGCGGCGGCGGCGGTCCATGGTCGTGCGGGCCGGCGGGCCGCCGAGCACGAACGCGCTCATCCTGGCGTTCGTCCTGCCGCTCTCCCTCTTCGTCGGCACGCTCATCACCGCCGCCCGCGTCGCCGACGACCTCGACGAGCGCTTCCTACGCGAGATGGAGTCCAACAAAGCGATAATGGAAGAGAATGAGGACTTCGAGCAAGACGGCGGAGGCGAAGAAGAGGAGGAGGACGCCGAGCAGCCGGCGCCAGTGGAGAAGGAGGGAGTTCTTGTTGCTGCTGCTCCGCGCACTAGAAACAGGCCAAAGAGGGAGGTACAGTAG

Protein Sequence

>Os01g0940600
MAARGLAALSSPARVGASATPCSGRPVRVSATPAAGGWRRRRRSMVVRAGGPPSTNALIL
AFVLPLSLFVGTLITAARVADDLDERFLREMESNKAIMEENEDFEQDGGGEEEEEDAEQP
APVEKEGVLVAAAPRTRNRPKREVQ*

Gene Information

Basic Gene Information

Gene Categorization (Help)

Gene Family

Gene Distribution (Help)

Gene Presence Frequency

Gene Ontology

CDS(Coding DNA Sequence)

Protein Sequence