Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
5253	irgsp1_rep	chr02	1793875	1796979	+	417	6	Os02g0134000

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Family

GF4930	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0004595	pantetheine-phosphate adenylyltransferase activity
GO:0005524	ATP binding
GO:0005634	nucleus
GO:0005829	cytosol
GO:0006629	lipid metabolic process
GO:0006970	response to osmotic stress
GO:0009058	biosynthetic process
GO:0009651	response to salt stress
GO:0015937	coenzyme A biosynthetic process
GO:0016779	nucleotidyltransferase activity
GO:0019344	cysteine biosynthetic process
GO:0019915	lipid storage
GO:0040007	growth
GO:0080020	regulation of coenzyme A biosynthetic process

CDS(Coding DNA Sequence)

>Os02g0134000
TCGGCATCTGCGACGGCCCTATGCTCGCCAAGAAACAGGCCATATGCTTACCTGATACAGCCAATCGAAAAGCGAATGGAAAATGTTAAGGAGTATATCAAGTCCATCAAGCCTGATCTTGAAGTTCATGTCGAGCCAATCGTGGACCCCTTTGGCCCCTCCATTGTTGACGAAGCTTTAGAAGCAATCATCGTCAGTAAGGAGACTTTGCCAGGAGGGCTTGCTGTCAACAGGAAGAGAGCTGAGAGAGGCCTCGCACAACTTGAGATTGAAGTGGTGGAACTGGTGCCGGAGAAGTCTACAGGGAACAAGATAAGCTCTACAGCATTCAGGAAGAAGGAAGCCGAGAGGGAATTGCACAAGCAGCAGCAGGAGGCACCACATGAACAAGCAGTTGAACTTGAGTGCAGAATATAA

Protein Sequence

>Os02g0134000
SASATALCSPRNRPYAYLIQPIEKRMENVKEYIKSIKPDLEVHVEPIVDPFGPSIVDEAL
EAIIVSKETLPGGLAVNRKRAERGLAQLEIEVVELVPEKSTGNKISSTAFRKKEAERELH
KQQQEAPHEQAVELECRI*