Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
5569	irgsp1_rep	chr02	4141509	4143652	+	288	2	Os02g0175800

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS3

Gene Family

GF8882	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0003674	molecular_function
GO:0005739	mitochondrion
GO:0005753	mitochondrial proton-transporting ATP synthase complex
GO:0006096	glycolytic process
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0008150	biological_process
GO:0009060	aerobic respiration
GO:0009536	plastid
GO:0009853	photorespiration
GO:0046686	response to cadmium ion
GO:0051788	response to misfolded protein
GO:0080129	proteasome core complex assembly

CDS(Coding DNA Sequence)

>Os02g0175800
ATGGCGCTGCGAGCCCTGATCAGCGAGATCCGGGGGATGAAGGTGCGGGAGGTGCCGGGGTACCTGAAGCCGCGGCTGAGCTGGGAGAACGTGAAGAAGAGCAGCGACCAGGCCGTCGACCGCTACATCGACAAGTACATCGAGACCAGCTCGCCGGAGCCGCTCTTCCACGTCATCTACGGCCTCATGGCCTTCTCCTACCTCATCAACCTCCCCAAGGAGCGCCGCCACCTCGCCCACCTCGAGGAGCTCGAGAGGCAGGGCGCCGCCGGCGCCGCCCACCACTAG

Protein Sequence

>Os02g0175800
MALRALISEIRGMKVREVPGYLKPRLSWENVKKSSDQAVDRYIDKYIETSSPEPLFHVIY
GLMAFSYLINLPKERRHLAHLEELERQGAAGAAHH*