Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
6456	irgsp1_rep	chr02	13962353	13967573	-	126	6	Os02g0437300

Core gene	No
Candidate core gene	No
Distributed gene	Yes
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	Yes
Gene age	PS13

GF9177	Distributed Gene Family

GO:0005515	protein binding
GO:0005623	cell
GO:0005737	cytoplasm
GO:0005794	Golgi apparatus
GO:0005802	trans-Golgi network
GO:0006612	protein targeting to membrane
GO:0006623	protein targeting to vacuole
GO:0006816	calcium ion transport
GO:0006820	anion transport
GO:0006862	nucleotide transport
GO:0006882	cellular zinc ion homeostasis
GO:0006886	intracellular protein transport
GO:0006888	ER to Golgi vesicle-mediated transport
GO:0006904	vesicle docking involved in exocytosis
GO:0008565	protein transporter activity
GO:0009306	protein secretion
GO:0009624	response to nematode
GO:0009705	plant-type vacuole membrane
GO:0010363	regulation of plant-type hypersensitive response
GO:0015696	ammonium transport
GO:0015802	basic amino acid transport
GO:0016192	vesicle-mediated transport
GO:0043069	negative regulation of programmed cell death
GO:0043090	amino acid import
GO:0043269	regulation of ion transport
GO:0061025	membrane fusion

>Os02g0437300
ATGATAATCATGTTCAATTTTAAAATCTCAATGACAATAAAAAAGGGAGACAACAGGCGAGCCATAAAGAAGTACAATGACAAAGCCGCTGACGGTTTGGTGGGACTTTTAGAAAGTAAAAAATGA

>Os02g0437300
MIIMFNFKISMTIKKGDNRRAIKKYNDKAADGLVGLLESKK*