Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
6997	irgsp1_rep	chr02	21165035	21165686	+	381	1	Os02g0558300

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Family

GF9373	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0000166	nucleotide binding
GO:0003824	catalytic activity
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0006777	Mo-molybdopterin cofactor biosynthetic process
GO:0006790	sulfur compound metabolic process
GO:0009734	auxin-activated signaling pathway
GO:0018315	molybdenum incorporation into molybdenum-molybdopterin complex
GO:0019008	molybdopterin synthase complex
GO:0030366	molybdopterin synthase activity

CDS(Coding DNA Sequence)

>Os02g0558300
ATCTGCAGCAGCGGAGCAGATCGGCATCCGCCGCTTCCTCCTCCTCCGGCGATGGCGCTGGATCCCAAAGCCAATCACGCTGCCGCTGCTGCTGCTTCCGCCGACAACCCCACGGCGGCGGCGGCGAAGGCGAAGGTGAAGGTGAAGGTGCTCTTCTTCGCCCGCGCGCGGGACCTGACGGGCGTGACGgaggccccggtggaggtgccggcagggagcacggcgggagactgcctcgcccgggtgctggccgccttccccaggctggaggagatccggcgatccatggtgctcgcgctcaacgaggagtacgcgcccgaggacgccgccgtcggggacggcgacgagcTCGCCATCATCCCGCCCATCAGCGGCGGCTGA

Protein Sequence

>Os02g0558300
ICSSGADRHPPLPPPPAMALDPKANHAAAAAASADNPTAAAAKAKVKVKVLFFARARDLT
GVTEAPVEVPAGSTAGDCLARVLAAFPRLEEIRRSMVLALNEEYAPEDAAVGDGDELAII
PPISGG*