Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
47548	maker	unaln_JG7	1750304	1750591	+	288	1	Un_maker_23719

Gene Categorization (Help)

Core gene	No
Candidate core gene	No
Distributed gene	Yes
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	Yes
Gene age	PS1

Gene Family

GF22	Core Gene Family

Gene Distribution (Help)

This gene can not be found in the 453 high-quality rice accessions but can be found in the 3,010 rice accessions.

Gene Presence Frequency

This gene can not be found in the 453 high-quality rice accessions but can be found in the 3,010 rice accessions.

The information about subspecies and subgroups.

Gene Ontology

GO:0000166	nucleotide binding
GO:0003690	double-stranded DNA binding
GO:0003697	single-stranded DNA binding
GO:0003723	RNA binding
GO:0005739	mitochondrion
GO:0006364	rRNA processing
GO:0006970	response to osmotic stress
GO:0009409	response to cold
GO:0009414	response to water deprivation
GO:0009651	response to salt stress
GO:0009664	plant-type cell wall organization
GO:0042545	cell wall modification

CDS(Coding DNA Sequence)

>Un_maker_23719
ATGACGAACAGACTCTATGTAGGCAACCTCGCTTTCAGCACCGATCAGCAGTCGCTGCAAGATGCCTTCTCGCGCATCGGTCCTGTCGACGACGTGAAGATCGTGATGGACCGCGAGACCGGTCGCTCACGGGGGTTCGCCTTCGTGACGATGGCCGACGCCGACGGAGCGCAGAAGGCGATCCAGGCGCTCGACGGGCAGCTGGTCGACGGCCGTGCGCTCCGCGTGAACGTCGCCGAGGCGCGCCAGGGCACGCCGTCGCGGGGCGCACCTCGCCGGAGCTGGTGA

Protein Sequence

>Un_maker_23719
MTNRLYVGNLAFSTDQQSLQDAFSRIGPVDDVKIVMDRETGRSRGFAFVTMADADGAQKAIQALDGQLVDGRALRVNVAEARQGTPSRGAPRRSW*