Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
50389	maker	unaln_Adm	3644182	3644595	-	414	1	Un_maker_315647

Gene Categorization (Help)

Core gene	No
Candidate core gene	No
Distributed gene	Yes
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	Yes
Gene age	PS13

Gene Family

GF926	Core Gene Family

Gene Distribution (Help)

This gene can not be found in the 453 high-quality rice accessions but can be found in the 3,010 rice accessions.

Gene Presence Frequency

This gene can not be found in the 453 high-quality rice accessions but can be found in the 3,010 rice accessions.

The information about subspecies and subgroups.

Gene Ontology

No GO information.

CDS(Coding DNA Sequence)

>Un_maker_315647
ATGTCGGACGCCGTCCCCGTTGCCGCCGACATGGGAGGGAGCGCGAAGAGGGGCAGCTCCTTCCGCGGGCTGGCTCGCAAGGCGGGGGAGGCAGCGGCGCCGGTGGAGTCGGAGGAGGCGGCCCGCGAGGAGGGGAAGAAGAAGAAGAAGACGACGACGACGACGACCTCCACGGTGTACAGGATGAGCCAGGAGCAGATCGACGGCATCCTCTCGTGGGACCTCCCGGCGACCGACTACGAGCCCCGCGGCTTCTCCGACGAGACCATGGAGATGTGCGGCCACCTCATCATCAAGGGGTTCGAGGGCAGGAACCGCCTCCTCCGCAAGAGGAGGGAGCTGCAGCACTACGTCAGGGAGCAGCTCGAGCTCCATGGCGTCGTCGATATCGACGACCGCATGCAGTACATGTAG

Protein Sequence

>Un_maker_315647
MSDAVPVAADMGGSAKRGSSFRGLARKAGEAAAPVESEEAAREEGKKKKKTTTTTTSTVYRMSQEQIDGILSWDLPATDYEPRGFSDETMEMCGHLIIKGFEGRNRLLRKRRELQHYVREQLELHGVVDIDDRMQYM*