Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
50443	maker	unaln_Adm	4561595	4562233	-	261	2	Un_maker_326444

Gene Categorization (Help)

Core gene	Yes
Candidate core gene	No
Distributed gene	No
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	No
Gene age	PS1

Gene Family

GF97	Core Gene Family

Gene Distribution (Help)

This gene presents in all high-quality rice accessions.

Gene Presence Frequency

The information about subspecies and subgroups.

Gene Ontology

GO:0003735	structural constituent of ribosome
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0006412	translation
GO:0030529	intracellular ribonucleoprotein complex
GO:0044351	macropinocytosis

CDS(Coding DNA Sequence)

>Un_maker_326444
ATGCAGATCTTCGTGAGGACGCTGGACGAGTGCATCACGCTCGAGGTCGAGGGCAGCGACTCCATCGGCGACGTCAAGGTCAAGATCCACGACAAGAACGGCATCCCGGCGGACGACCAGCGGCTGATGCACGCCGGGAGGCAGCTGGATGATCGACGGACGCTGGCCGACTACGGCATCCAGACGGAGCACACGCTTCGCCTCGCCATTCGTCTCCGCCGCCGCGGCCAACCTCCTCACACTCGCGCTCAAGCACAATGA

Protein Sequence

>Un_maker_326444
MQIFVRTLDECITLEVEGSDSIGDVKVKIHDKNGIPADDQRLMHAGRQLDDRRTLADYGIQTEHTLRLAIRLRRRGQPPHTRAQAQ*