Gene Information

Basic Gene Information

ID	source	chrom	start	end	strand	CDS length	exon number	gene ID	visualization
36988	maker	unaln_IG1	29002475	29002825	+	351	1	Un_maker_341663

Gene Categorization (Help)

Core gene	No
Candidate core gene	No
Distributed gene	Yes
Subspecies-unbalanced gene	No
Indica-dominant gene	No
Japonica-dominant gene	No
Subspecies-specific gene	No
Indica-specific gene	No
Japonica-specific gene	No
AUS-specific gene	No
ARO-specific gene	No
Subgroup-unbalanced gene	No
Indica-subgroup-unbalanced gene	No
Japonica-subgroup-unbalanced gene	No
Random gene	Yes
Gene age	PS1

Gene Family

GF1350	Core Gene Family

Gene Distribution (Help)

This gene can not be found in the 453 high-quality rice accessions but can be found in the 3,010 rice accessions.

Gene Presence Frequency

This gene can not be found in the 453 high-quality rice accessions but can be found in the 3,010 rice accessions.

The information about subspecies and subgroups.

Gene Ontology

GO:0005776	autophagosome
GO:0006914	autophagy
GO:0008340	determination of adult lifespan
GO:0010506	regulation of autophagy
GO:0016236	macroautophagy
GO:0019901	protein kinase binding
GO:0031386	protein tag
GO:0031396	regulation of protein ubiquitination
GO:0034423	autophagosome lumen
GO:0035096	larval midgut cell programmed cell death
GO:0044753	amphisome
GO:0044754	autolysosome

CDS(Coding DNA Sequence)

>Un_maker_341663
ATGAAATTTAGCTACAAGGAGGAGAATGATTTCGCCAAGCGCAAAGCTGAGGGCGAAAAGATTCGGAAGAAGTATCCGGACAGAGTTCCAGTTATCGTCGAGAAAGCACCAAAAGCAAGGATTGGAGAATTGGACAAGAAGAAATATTTAGTGCCATCTGATTTGACAGTGGGCCAATTTTATTTTCTCATCAGGAAGAGGATCCAATTGAGACCCGAGGACGCATTGTTTTTCTTTGTCAACAATTGCATACCACCAACTAGCTATACTATGGGCTCCCTCTATCAGGAACATCATGAAGATGATTACTTCTTGTACATAGCATTCTCGGATGAATCTGTATACGGATAA

Protein Sequence

>Un_maker_341663
MKFSYKEENDFAKRKAEGEKIRKKYPDRVPVIVEKAPKARIGELDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNCIPPTSYTMGSLYQEHHEDDYFLYIAFSDESVYG*